NameInterleukin-1 beta
Synonyms
  • Catabolin
  • IL-1 beta
  • IL1F2
Gene NameIL1B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010736|Interleukin-1 beta
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Number of residues269
Molecular Weight30747.7
Theoretical pI4.45
GO Classification
Functions
  • cytokine activity
  • interleukin-1 receptor binding
  • protein domain specific binding
Processes
  • positive regulation of gene expression
  • cellular response to organic substance
  • monocyte aggregation
  • purine nucleobase metabolic process
  • positive regulation of chemokine biosynthetic process
  • response to stilbenoid
  • response to ethanol
  • response to vitamin D
  • negative regulation of adiponectin secretion
  • signal transduction
  • negative regulation of transcription from RNA polymerase II promoter
  • positive regulation of interleukin-6 biosynthetic process
  • sequestering of triglyceride
  • cellular response to mechanical stimulus
  • positive regulation of interferon-gamma production
  • ovulation
  • negative regulation of branching morphogenesis of a nerve
  • protein kinase B signaling
  • positive regulation of membrane protein ectodomain proteolysis
  • smooth muscle adaptation
  • positive regulation of transcription, DNA-templated
  • positive regulation of interleukin-2 biosynthetic process
  • negative regulation of MAP kinase activity
  • negative regulation of lipid metabolic process
  • cytokine-mediated signaling pathway
  • negative regulation of neuron differentiation
  • response to estradiol
  • response to peptide hormone
  • aging
  • positive regulation of nitric oxide biosynthetic process
  • negative regulation of neural precursor cell proliferation
  • social behavior
  • positive regulation of neutrophil chemotaxis
  • apoptotic process
  • positive regulation of heterotypic cell-cell adhesion
  • cellular response to antibiotic
  • pentacyclic triterpenoid metabolic process
  • positive regulation of myosin light chain kinase activity
  • inflammatory response
  • lipopolysaccharide-mediated signaling pathway
  • positive regulation of sequence-specific DNA binding transcription factor activity
  • MAPK cascade
  • embryo implantation
  • cellular response to organic cyclic compound
  • polyketide metabolic process
  • positive regulation of NF-kappaB import into nucleus
  • estrogen metabolic process
  • negative regulation of cell proliferation
  • negative regulation of glutamate secretion
  • response to gamma radiation
  • positive regulation of astrocyte differentiation
  • positive regulation of protein export from nucleus
  • positive regulation of ERK1 and ERK2 cascade
  • cellular response to fatty acid
  • positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • positive regulation of cell adhesion molecule production
  • positive regulation of T cell mediated immunity
  • cell-cell signaling
  • positive regulation of mitotic nuclear division
  • negative regulation of lipid catabolic process
  • cellular response to methotrexate
  • response to hypoxia
  • cellular response to glucose stimulus
  • positive regulation of granulocyte macrophage colony-stimulating factor production
  • regulation of establishment of endothelial barrier
  • memory
  • positive regulation of JNK cascade
  • chronic inflammatory response to antigenic stimulus
  • stimulatory C-type lectin receptor signaling pathway
  • positive regulation of NF-kappaB transcription factor activity
  • positive regulation of histone acetylation
  • regulation of I-kappaB kinase/NF-kappaB signaling
  • cellular response to drug
  • positive regulation of vascular endothelial growth factor receptor signaling pathway
  • ectopic germ cell programmed cell death
  • extrinsic apoptotic signaling pathway in absence of ligand
  • wound healing
  • negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
  • positive regulation of histone phosphorylation
  • response to dexamethasone
  • positive regulation of angiogenesis
  • response to ATP
  • fever generation
  • regulation of insulin secretion
  • positive regulation of JUN kinase activity
  • positive regulation of immature T cell proliferation in thymus
  • response to diuretic
  • innate immune response
  • positive regulation of interleukin-8 production
  • response to heat
  • glycoprotein metabolic process
  • neutrophil chemotaxis
  • negative regulation of glucose transport
  • positive regulation of lipid catabolic process
  • response to L-ascorbic acid
  • positive regulation of apoptotic process
  • activation of MAPK activity
  • positive regulation of fever generation
  • hyaluronan biosynthetic process
  • positive regulation of interleukin-6 production
  • negative regulation of insulin receptor signaling pathway
  • positive regulation of monocyte chemotactic protein-1 production
  • response to ozone
  • positive regulation of cytosolic calcium ion concentration
  • positive regulation of vascular endothelial growth factor production
  • response to morphine
  • positive regulation of prostaglandin secretion
  • interleukin-1 beta production
  • positive regulation of phagocytosis
  • positive regulation of calcidiol 1-monooxygenase activity
  • response to statin
  • positive regulation of protein phosphorylation
  • positive regulation of T cell proliferation
Components
  • secretory granule
  • extracellular region
  • extracellular space
  • lysosome
  • autophagosome
  • cytosol
  • extracellular exosome
General FunctionProtein domain specific binding
Specific FunctionPotent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID307043
UniProtKB IDP01584
UniProtKB Entry NameIL1B_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010737|Interleukin-1 beta (IL1B)
ATGGCAGAAGTACCTGAGCTCGCCAGTGAAATGATGGCTTATTACAGTGGCAATGAGGAT
GACTTGTTCTTTGAAGCTGATGGCCCTAAACAGATGAAGTGCTCCTTCCAGGACCTGGAC
CTCTGCCCTCTGGATGGCGGCATCCAGCTACGAATCTCCGACCACCACTACAGCAAGGGC
TTCAGGCAGGCCGCGTCAGTTGTTGTGGCCATGGACAAGCTGAGGAAGATGCTGGTTCCC
TGCCCACAGACCTTCCAGGAGAATGACCTGAGCACCTTCTTTCCCTTCATCTTTGAAGAA
GAACCTATCTTCTTCGACACATGGGATAACGAGGCTTATGTGCACGATGCACCTGTACGA
TCACTGAACTGCACGCTCCGGGACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATAT
GAACTGAAAGCTCTCCACCTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATG
TCCTTTGTACAAGGAGAAGAAAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAA
AAGAATCTGTACCTGTCCTGCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGT
GTAGATCCCAAAAATTACCCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATA
GAAATCAATAACAAGCTGGAATTTGAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACC
TCTCAAGCAGAAAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACT
GACTTCACCATGCAATTTGTGTCTTCCTAA
GenBank Gene IDK02770
GeneCard IDNot Available
GenAtlas IDIL1B
HGNC IDHGNC:5992
Chromosome Location2
Locus2q14
References
  1. Auron PE, Webb AC, Rosenwasser LJ, Mucci SF, Rich A, Wolff SM, Dinarello CA: Nucleotide sequence of human monocyte interleukin 1 precursor cDNA. Proc Natl Acad Sci U S A. 1984 Dec;81(24):7907-11. 6083565
  2. March CJ, Mosley B, Larsen A, Cerretti DP, Braedt G, Price V, Gillis S, Henney CS, Kronheim SR, Grabstein K, et al.: Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs. Nature. 1985 Jun 20-26;315(6021):641-7. 2989698
  3. Clark BD, Collins KL, Gandy MS, Webb AC, Auron PE: Genomic sequence for human prointerleukin 1 beta: possible evolution from a reverse transcribed prointerleukin 1 alpha gene. Nucleic Acids Res. 1986 Oct 24;14(20):7897-914. 3490654
  4. Nishida T, Nishino N, Takano M, Kawai K, Bando K, Masui Y, Nakai S, Hirai Y: cDNA cloning of IL-1 alpha and IL-1 beta from mRNA of U937 cell line. Biochem Biophys Res Commun. 1987 Feb 27;143(1):345-52. 3493774
  5. Bensi G, Raugei G, Palla E, Carinci V, Tornese Buonamassa D, Melli M: Human interleukin-1 beta gene. Gene. 1987;52(1):95-101. 2954882
  6. Kotenko SV, Bulenkov MT, Veiko VP, Epishin SM, Lomakin IB: [Cloning of the cDNA coding for human prointerleukin-1 alpha and prointerleukin-1 beta]. Dokl Akad Nauk SSSR. 1989;309(4):1005-8. 2635664
  7. Nicklin MJ, Barton JL, Nguyen M, FitzGerald MG, Duff GW, Kornman K: A sequence-based map of the nine genes of the human interleukin-1 cluster. Genomics. 2002 May;79(5):718-25. 11991722
  8. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  10. Mizutani H, Schechter N, Lazarus G, Black RA, Kupper TS: Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase. J Exp Med. 1991 Oct 1;174(4):821-5. 1919436
  11. Van Damme J, De Ley M, Opdenakker G, Billiau A, De Somer P, Van Beeumen J: Homogeneous interferon-inducing 22K factor is related to endogenous pyrogen and interleukin-1. Nature. 1985 Mar 21-27;314(6008):266-8. 3920526
  12. Zsebo KM, Wypych J, Yuschenkoff VN, Lu H, Hunt P, Dukes PP, Langley KE: Effects of hematopoietin-1 and interleukin 1 activities on early hematopoietic cells of the bone marrow. Blood. 1988 Apr;71(4):962-8. 3281727
  13. Nanduri VB, Hulmes JD, Pan YC, Kilian PL, Stern AS: The role of arginine residues in interleukin 1 receptor binding. Biochim Biophys Acta. 1991 Dec 11;1118(1):25-35. 1837236
  14. MacKenzie A, Wilson HL, Kiss-Toth E, Dower SK, North RA, Surprenant A: Rapid secretion of interleukin-1beta by microvesicle shedding. Immunity. 2001 Nov;15(5):825-35. 11728343
  15. Andrei C, Margiocco P, Poggi A, Lotti LV, Torrisi MR, Rubartelli A: Phospholipases C and A2 control lysosome-mediated IL-1 beta secretion: Implications for inflammatory processes. Proc Natl Acad Sci U S A. 2004 Jun 29;101(26):9745-50. Epub 2004 Jun 10. 15192144
  16. Papin S, Cuenin S, Agostini L, Martinon F, Werner S, Beer HD, Grutter C, Grutter M, Tschopp J: The SPRY domain of Pyrin, mutated in familial Mediterranean fever patients, interacts with inflammasome components and inhibits proIL-1beta processing. Cell Death Differ. 2007 Aug;14(8):1457-66. Epub 2007 Apr 13. 17431422
  17. Piccioli P, Rubartelli A: The secretion of IL-1beta and options for release. Semin Immunol. 2013 Dec 15;25(6):425-9. doi: 10.1016/j.smim.2013.10.007. Epub 2013 Nov 5. 24201029
  18. Baroja-Mazo A, Martin-Sanchez F, Gomez AI, Martinez CM, Amores-Iniesta J, Compan V, Barbera-Cremades M, Yague J, Ruiz-Ortiz E, Anton J, Bujan S, Couillin I, Brough D, Arostegui JI, Pelegrin P: The NLRP3 inflammasome is released as a particulate danger signal that amplifies the inflammatory response. Nat Immunol. 2014 Aug;15(8):738-48. doi: 10.1038/ni.2919. Epub 2014 Jun 22. 24952504
  19. Priestle JP, Schar HP, Grutter MG: Crystal structure of the cytokine interleukin-1 beta. EMBO J. 1988 Feb;7(2):339-43. 3259176
  20. Finzel BC, Clancy LL, Holland DR, Muchmore SW, Watenpaugh KD, Einspahr HM: Crystal structure of recombinant human interleukin-1 beta at 2.0 A resolution. J Mol Biol. 1989 Oct 20;209(4):779-91. 2585509
  21. Priestle JP, Schar HP, Grutter MG: Crystallographic refinement of interleukin 1 beta at 2.0 A resolution. Proc Natl Acad Sci U S A. 1989 Dec;86(24):9667-71. 2602367
  22. Driscoll PC, Gronenborn AM, Wingfield PT, Clore GM: Determination of the secondary structure and molecular topology of interleukin-1 beta by use of two- and three-dimensional heteronuclear 15N-1H NMR spectroscopy. Biochemistry. 1990 May 15;29(19):4668-82. 2372550
  23. Clore GM, Wingfield PT, Gronenborn AM: High-resolution three-dimensional structure of interleukin 1 beta in solution by three- and four-dimensional nuclear magnetic resonance spectroscopy. Biochemistry. 1991 Mar 5;30(9):2315-23. 2001363
  24. Vigers GP, Anderson LJ, Caffes P, Brandhuber BJ: Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta. Nature. 1997 Mar 13;386(6621):190-4. 9062193
  25. Wang D, Zhang S, Li L, Liu X, Mei K, Wang X: Structural insights into the assembly and activation of IL-1beta with its receptors. Nat Immunol. 2010 Oct;11(10):905-11. doi: 10.1038/ni.1925. Epub 2010 Aug 29. 20802483