NameInterleukin-2
Synonyms
  • IL-2
  • T-cell growth factor
  • TCGF
Gene NameIL2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002049|Interleukin-2
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
Number of residues153
Molecular Weight17627.52
Theoretical pI7.95
GO Classification
Functions
  • cytokine activity
  • carbohydrate binding
  • interleukin-2 receptor binding
  • glycosphingolipid binding
  • kinase activator activity
  • growth factor activity
Processes
  • insulin receptor signaling pathway
  • natural killer cell activation
  • MAPK cascade
  • immune response
  • positive regulation of B cell proliferation
  • negative regulation of apoptotic process
  • positive regulation of isotype switching to IgG isotypes
  • negative regulation of protein phosphorylation
  • neurotrophin TRK receptor signaling pathway
  • extrinsic apoptotic signaling pathway in absence of ligand
  • positive regulation of transcription from RNA polymerase II promoter
  • negative regulation of B cell apoptotic process
  • Ras protein signal transduction
  • small GTPase mediated signal transduction
  • vascular endothelial growth factor receptor signaling pathway
  • cell-cell signaling
  • negative regulation of heart contraction
  • positive regulation of cell growth
  • T cell differentiation
  • positive regulation of cell proliferation
  • axon guidance
  • positive regulation of dendritic spine development
  • protein kinase C-activating G-protein coupled receptor signaling pathway
  • epidermal growth factor receptor signaling pathway
  • positive regulation of activated T cell proliferation
  • positive regulation of inflammatory response
  • innate immune response
  • positive regulation of interleukin-17 production
  • negative regulation of inflammatory response
  • positive regulation of cytosolic calcium ion concentration
  • positive regulation of tissue remodeling
  • positive regulation of tyrosine phosphorylation of Stat5 protein
  • Fc-epsilon receptor signaling pathway
  • negative regulation of lymphocyte proliferation
  • cell adhesion
  • positive regulation of interferon-gamma production
  • activation of MAPKK activity
  • positive regulation of regulatory T cell differentiation
  • positive regulation of immunoglobulin secretion
  • fibroblast growth factor receptor signaling pathway
  • regulation of T cell homeostatic proliferation
  • adaptive immune response
Components
  • extracellular space
  • cytosol
  • intracellular
  • extracellular region
General FunctionKinase activator activity
Specific FunctionProduced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID5729676
UniProtKB IDP60568
UniProtKB Entry NameIL2_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0016290|Interleukin-2 (IL2)
ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGT
GCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGAT
TTACAGATGATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTC
ACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTAGAA
GAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTA
AGACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAA
ACAACATTCATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGA
TGGATTACCTTTTGTCAAAGCATCATCTCAACACTGACTTGA
GenBank Gene IDJ00264
GeneCard IDNot Available
GenAtlas IDIL2
HGNC IDHGNC:6001
Chromosome Location4
Locus4q26-q27
References
  1. Maeda S, Nishino N, Obaru K, Mita S, Nomiyama H, Shimada K, Fujimoto K, Teranishi T, Hirano T, Onoue K: Cloning of interleukin 2 mRNAs from human tonsils. Biochem Biophys Res Commun. 1983 Sep 30;115(3):1040-7. 6312994
  2. Taniguchi T, Matsui H, Fujita T, Takaoka C, Kashima N, Yoshimoto R, Hamuro J: Structure and expression of a cloned cDNA for human interleukin-2. Nature. 1983 Mar 24-30;302(5906):305-10. 6403867
  3. Devos R, Plaetinck G, Cheroutre H, Simons G, Degrave W, Tavernier J, Remaut E, Fiers W: Molecular cloning of human interleukin 2 cDNA and its expression in E. coli. Nucleic Acids Res. 1983 Jul 11;11(13):4307-23. 6306584
  4. Fujita T, Takaoka C, Matsui H, Taniguchi T: Structure of the human interleukin 2 gene. Proc Natl Acad Sci U S A. 1983 Dec;80(24):7437-41. 6324170
  5. Holbrook NJ, Lieber M, Crabtree GR: DNA sequence of the 5' flanking region of the human interleukin 2 gene: homologies with adult T-cell leukemia virus. Nucleic Acids Res. 1984 Jun 25;12(12):5005-13. 6330695
  6. Holbrook NJ, Smith KA, Fornace AJ Jr, Comeau CM, Wiskocil RL, Crabtree GR: T-cell growth factor: complete nucleotide sequence and organization of the gene in normal and malignant cells. Proc Natl Acad Sci U S A. 1984 Mar;81(6):1634-8. 6608729
  7. Eizenberg O, Faber-Elman A, Lotan M, Schwartz M: Interleukin-2 transcripts in human and rodent brains: possible expression by astrocytes. J Neurochem. 1995 May;64(5):1928-36. 7722480
  8. Chernicky CL, Tan H, Burfeind P, Ilan J, Ilan J: Sequence of interleukin-2 isolated from human placental poly A+ RNA: possible role in maintenance of fetal allograft. Mol Reprod Dev. 1996 Feb;43(2):180-6. 8824916
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  10. Siebenlist U, Durand DB, Bressler P, Holbrook NJ, Norris CA, Kamoun M, Kant JA, Crabtree GR: Promoter region of interleukin-2 gene undergoes chromatin structure changes and confers inducibility on chloramphenicol acetyltransferase gene during activation of T cells. Mol Cell Biol. 1986 Sep;6(9):3042-9. 3491296
  11. Weir MP, Chaplin MA, Wallace DM, Dykes CW, Hobden AN: Structure-activity relationships of recombinant human interleukin 2. Biochemistry. 1988 Sep 6;27(18):6883-92. 3264184
  12. Robb RJ, Kutny RM, Panico M, Morris HR, Chowdhry V: Amino acid sequence and post-translational modification of human interleukin 2. Proc Natl Acad Sci U S A. 1984 Oct;81(20):6486-90. 6333684
  13. Conradt HS, Nimtz M, Dittmar KE, Lindenmaier W, Hoppe J, Hauser H: Expression of human interleukin-2 in recombinant baby hamster kidney, Ltk-, and Chinese hamster ovary cells. Structure of O-linked carbohydrate chains and their location within the polypeptide. J Biol Chem. 1989 Oct 15;264(29):17368-73. 2793860
  14. Laabi Y, Gras MP, Carbonnel F, Brouet JC, Berger R, Larsen CJ, Tsapis A: A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma. EMBO J. 1992 Nov;11(11):3897-904. 1396583
  15. Brandhuber BJ, Boone T, Kenney WC, McKay DB: Three-dimensional structure of interleukin-2. Science. 1987 Dec 18;238(4834):1707-9. 3500515
  16. Bazan JF: Unraveling the structure of IL-2. Science. 1992 Jul 17;257(5068):410-3. 1631562
  17. Mott HR, Driscoll PC, Boyd J, Cooke RM, Weir MP, Campbell ID: Secondary structure of human interleukin 2 from 3D heteronuclear NMR experiments. Biochemistry. 1992 Aug 25;31(33):7741-4. 1510960
  18. Bamborough P, Hedgecock CJ, Richards WG: The interleukin-2 and interleukin-4 receptors studied by molecular modelling. Structure. 1994 Sep 15;2(9):839-51. 7529123
  19. Wang X, Rickert M, Garcia KC: Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors. Science. 2005 Nov 18;310(5751):1159-63. 16293754
  20. Stauber DJ, Debler EW, Horton PA, Smith KA, Wilson IA: Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proc Natl Acad Sci U S A. 2006 Feb 21;103(8):2788-93. Epub 2006 Feb 13. 16477002